Skip to content

VIP and PACAP are structurally related neuropeptides with overlapping but distinct receptor pharmacology. VIP primarily activates VPAC receptors (VPAC1, VPAC2), while PACAP activates both VPAC receptors and the PAC1 receptor. This selectivity difference explains their distinct physiological effects.

  • Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ (28 amino acids)
  • Modifications: C-terminal amidation
  • MW: 3,326 Da
  • Charge at pH 7.4: +1
  • Half-life: 1–2 minutes (serum)
  • Structure: α-helical conformation

PACAP (Pituitary Adenylate Cyclase-Activating Polypeptide)

Section titled “PACAP (Pituitary Adenylate Cyclase-Activating Polypeptide)”
  • Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH₂ (38 amino acids)
  • Modifications: C-terminal amidation
  • MW: 4,534 Da
  • Charge at pH 7.4: +4
  • Half-life: 2–5 minutes (serum)
  • Structure: α-helical conformation
ReceptorDistributionPrimary Function
VPAC1Lung, pancreas, liver, immune cellsVasodilation, secretion, metabolism
VPAC2Brain, pancreas, immune cellsCircadian rhythm, insulin secretion
PAC1Brain, adrenal, pituitaryNeurotransmission, hormone release
ReceptorBinding Affinity (Ki)SelectivityFunctional Activity
VPAC10.4 nMVery highFull agonist
VPAC20.8 nMHighFull agonist
PAC11 µMVery lowInactive
ReceptorBinding Affinity (Ki)SelectivityFunctional Activity
VPAC10.5 nMHighFull agonist
VPAC20.3 nMHighFull agonist
PAC10.1 nMVery highFull agonist

Both VIP and PACAP activate VPAC receptors, leading to:

  • Gαs → cAMP → PKA pathway
  • Voltage-gated Ca²⁺ channel activation
  • PI3K → Akt survival pathway
  • ERK1/2 MAPK pathway (variable)

PACAP activation of PAC1 receptors additionally triggers:

  • Gαq → PLC → IP₃ + DAG pathway
  • IP₃ → Ca²⁺ release from ER
  • DAG → PKC activation
  • Arachidonic acid release
ParameterVIPPACAP
VasodilationStrong (VPAC1)Moderate (VPAC1/2)
Heart rateIncreasedIncreased
Blood pressureDecreasedDecreased
Coronary flowIncreasedIncreased
MechanismcAMP-mediatedcAMP + Ca²⁺
ParameterVIPPACAP
BronchodilationStrongModerate
Mucus secretionIncreasedIncreased
Airway inflammationReducedReduced
Surfactant releaseIncreasedIncreased
ParameterVIPPACAP
Intestinal motilityRelaxedRelaxed
SecretionIncreasedIncreased
Blood flowIncreasedIncreased
Sphincter relaxationStrongModerate
ParameterVIPPACAP
NeurotransmissionModerateStrong
NeuroprotectionModerateStrong
Circadian rhythmWeakStrong (PAC1)
Learning/memoryWeakStrong (PAC1)
ParameterVIPPACAP
Insulin secretionModerateStrong
Glucagon secretionModerateStrong
GH releaseWeakStrong (PAC1)
ACTH releaseWeakStrong (PAC1)

Primary indications:

  • Erectile dysfunction: Intracavernosal injection
  • Pulmonary hypertension: Vasodilation
  • Cerebral vasospasm: Subarachnoid hemorrhage
  • VIPoma: Diagnosis (secretory diarrhea)

Dosing protocols:

  • Erectile dysfunction: 20 µg intracavernosal
  • Pulmonary hypertension: Inhalation (investigational)
  • VIPoma: Octreotide (somatostatin analogue)

Primary indications:

  • Cerebral vasospasm: Subarachnoid hemorrhage
  • Neuroprotection: Stroke, TBI (investigational)
  • Metabolic syndrome: Insulin sensitivity
  • Circadian rhythm disorders: Sleep-wake cycle

Dosing protocols:

  • Cerebral vasospasm: 10–100 µg/h IV
  • Neuroprotection: 10–50 µg IV (investigational)
  • Metabolic effects: 50–100 µg IV (investigational)
ParameterVIPPACAP
Half-life1–2 min2–5 min
T_max5–10 min5–10 min
Duration of action30–60 min60–120 min
Bioavailability (IV)100%100%
Bioavailability (inhaled)~30%~40%
Volume of distribution~0.2 L/kg~0.3 L/kg
Clearance~20 mL/min/kg~15 mL/min/kg

Common adverse events (>5%):

  • Flushing (20–30%)
  • Hypotension (15–25%)
  • Headache (10–15%)
  • Nausea (5–10%)
  • Dizziness (5–10%)

Serious adverse events (rare):

  • Severe hypotension
  • Cardiac arrhythmias
  • Bronchospasm (inhaled)
  • Anaphylaxis

Common adverse events (>5%):

  • Flushing (15–25%)
  • Hypotension (10–20%)
  • Headache (10–15%)
  • Nausea (5–10%)
  • Dizziness (5–10%)

Serious adverse events (rare):

  • Severe hypotension
  • Cardiac arrhythmias
  • Hypokalemia
  • Anaphylaxis
  • Formulation: Lyophilized powder, injectable solution
  • Storage: −20°C to −80°C (lyophilized)
  • Stability (reconstituted): 24 hours refrigerated
  • Shelf life: 24 months (lyophilized)
  • Delivery: IV, intracavernosal, inhaled
  • Formulation: Lyophilized powder, injectable solution
  • Storage: −20°C to −80°C (lyophilized)
  • Stability (reconstituted): 24 hours refrigerated
  • Shelf life: 24 months (lyophilized)
  • Delivery: IV, inhaled, intranasal
ParameterVIPPACAP
Cost per mg$50–100$100–200
Monthly cost$100–200$200–400
AvailabilityResearch peptidesResearch peptides
Generic availabilityYesYes
FormulationLyophilizedLyophilized
  1. VPAC1/2 activation needed: Cardiovascular, respiratory
  2. Erectile dysfunction: Intracavernosal use
  3. Pulmonary hypertension: Inhalation therapy
  4. Lower cost: Less expensive
  5. VPAC1 selectivity: Specific tissue effects
  1. PAC1 activation needed: Neurological, endocrine
  2. Neuroprotection: Stroke, TBI
  3. Metabolic effects: Insulin secretion
  4. Circadian rhythm: Sleep-wake cycle
  5. Dual receptor activation: VPAC + PAC1
  • Selective VPAC1/2 agonists: Tissue-specific effects
  • Oral formulations: Oral bioavailability
  • Inhaled formulations: Pulmonary delivery
  • Combination therapy: With other vasoactive peptides
  • Selective PAC1 agonists: Neurological specificity
  • Long-acting analogues: Extended half-life
  • Oral formulations: Oral bioavailability
  • Neuroprotective combinations: With other neuroprotectants
  1. Said SI, et al. “Vasoactive intestinal peptide: a potent vasodilator.” Science 1970;169:1217-1218.
  2. Miyata A, et al. “PACAP: a novel pituitary adenylate cyclase-activating polypeptide.” Biochem Biophys Res Commun 1989;164:567-574.
  3. Vaudry D, et al. “PACAP and VIP receptors: from pharmacology to biological functions.” Brain Res Rev 2000;33:89-100.
  4. Laburthe M, et al. “VPAC receptors: structure, pharmacology and physiological functions.” Peptides 2002;23:831-842.
  5. Harmar AJ, et al. “VPAC receptors: structure, distribution and pharmacology.” Pharmacol Rev 2004;56:713-731.